How to read specific lines from a text file and store them in an array?
이전 댓글 표시
I have a text file containing an Multiple Sequence Alignment (MSA) which has protein sequences stored in it. The contents of the file is like this:
>gi|73961569|ref|XP_547536.2| osteocalcin [C. lupus familiaris] MRSLMVLALLAVAALCLCLAGPADAKPSSAESRKGGATFVSKREGSEVVRRLRRYLDSGL GAPVPYPDPLEPKREVCELNPNCDELADHIGFQEAYQRFYGPV-
>gi|27806301|ref|NP_776674.1| osteocalcin preproprotein
MRTPMLLALLALAT--LCLAGRADAKPGDAESGK-GAAFVSKQEGSEVVKRLRRYLDHWL GAPAPYPDPLEPKREVCELNPDCDELADHIGFQEAYRRFYGPV-
From this file I just want to extract the lines containing the actual sequences (ones NOT starting with '>' symbol) and store them in an array for future use. One thing to mention is that line 2 and line 3 is one single sequence, so I also need to make them a single string and store it in one single position of an array. How can I do that?
I wanted to use 'fileread' but it reads all the file at a time, so it's not helpful.
댓글 수: 1
per isakson
2015년 10월 20일
Delete one of my our two identical questions!
답변 (0개)
카테고리
도움말 센터 및 File Exchange에서 Text Files에 대해 자세히 알아보기
Community Treasure Hunt
Find the treasures in MATLAB Central and discover how the community can help you!
Start Hunting!