Community Profile

photo

Rasif Ajwad


4 2015 이후 총 참여 횟수

Rasif Ajwad's 배지

  • Thankful Level 1

세부 정보 보기...

참여 게시물
보기 기준

질문


How to put values in matrix based on some condition?
Hi, I have a matrix. I want put 0 value in (2,1), (3,1), (4,1), (5,1) ... (n,1) positions. ***Not in (1,1) position. Is it...

약 5년 전 | 답변 수: 1 | 0

1

답변

질문


How to copy specific columns of a character array to another character array?
I have a character array named 'seq' as following: MRSLMVLALLAVAALCLCLAGPADAKPSSAESRKGGATFVSKREGSEVVRRLRRYLDSGL MRTPMLLALL...

약 5년 전 | 답변 수: 1 | 0

1

답변

질문


How to read specific lines from a text file and store them in an array?
I have a text file containing an Multiple Sequence Alignment (MSA) which has protein sequences stored in it. The contents of the...

5년 이상 전 | 답변 수: 1 | 0

1

답변

질문


How to read specific lines from a text file and store them in an array?
I have a text file containing an Multiple Sequence Alignment (MSA) which has protein sequences stored in it. The contents of the...

5년 이상 전 | 답변 수: 0 | 0

0

답변